PDB entry 1ikc

View 1ikc on RCSB PDB site
Description: nmr structure of alpha-bungarotoxin
Deposited on 2001-05-03, released 2001-05-16
The last revision prior to the SCOP 1.57 freeze date was dated 2001-06-13, with a file datestamp of 2001-06-13.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1ikca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ikcA (A:)
  ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
  stdkcnphpkqrpg