PDB entry 1ik8

View 1ik8 on RCSB PDB site
Description: NMR structure of Alpha-Bungarotoxin
Class: toxin
Keywords: NMR, alpha-bungarotoxin, toxin, nicotinic-acetilcholine receptor
Deposited on 2001-05-03, released 2001-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: long neurotoxin 1
  Species: Bungarus multicinctus [TaxId:8616]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60615 (0-73)
  Domains in SCOPe 2.08: d1ik8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ik8A (A:)
  ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
  stdkcnphpkqrpg