PDB entry 1ik3

View 1ik3 on RCSB PDB site
Description: lipoxygenase-3 (soybean) complex with 13(s)-hydroperoxy-9(z),11(e)-octadecadienoic acid
Class: oxidoreductase
Keywords: oxidoreductase, purple lipoxygenase, fe(III) complex, interm
Deposited on 2001-05-01, released 2001-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipoxygenase-3
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ik3a1, d1ik3a2
  • Heterogens: FE, 13S, 13R, 9OH, 11O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ik3A (A:)
    mlggllhrghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvsl
    qlisatkadangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknf
    mqtefflvsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyr
    eeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgr
    kptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftpre
    fdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmt
    deefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiq
    nkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsg
    afsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvv
    hpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqal
    padlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlre
    dpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypyg
    glilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasde
    vylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllp
    sskegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ik3A (A:)
    ghkikgtvvlmrknvldvnsvtsvtldtltaflgrsvslqlisatkadangkgklgkatf
    legiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflvsltledipnhgsi
    hfvcnswiynaklfksdriffanqtylpsetpaplvkyreeelhnlrgdgtgerkeweri
    ydydvyndlgdpdkgenharpvlggndtfpyprrgrtgrkptrkdpnsesrsndvylprd
    eafghlkssdfltyglksvsqnvlpllqsafdlnftprefdsfdevhglysggiklptdi
    iskisplpvlkeifrtdgeqalkfpppkviqvsksawmtdeefaremlagvnpnlirclk
    dfpprskldsqvygdhtsqitkehlepnlegltvdeaiqnkrlflldhhdpimpylrrin
    atstkayatrtilflkndgtlrplaielslphpqgdqsgafsqvflpadegvessiwlla
    kayvvvndscyhqlvshwlnthavvepfiiatnrhlsvvhpiykllhphyrdtmningla
    rlslvndggvieqtflwgrysvemsavvykdwvftdqalpadlikrgmaiedpscphgir
    lviedypytvdgleiwdaiktwvheyvflyyksddtlredpelqacwkelvevghgdkkn
    epwwpkmqtreelveacaiiiwtasalhaavnfgqypygglilnrptlsrrfmpekgsae
    yeelrknpqkaylktitpkfqtlidlsvieilsrhasdevylgerdnpnwtsdtraleaf
    krfgnklaqienklsernndeklrnrcgpvqmpytlllpsskegltfrgipnsisi