PDB entry 1ik0

View 1ik0 on RCSB PDB site
Description: solution structure of human il-13
Deposited on 2001-05-01, released 2002-05-01
The last revision prior to the SCOP 1.69 freeze date was dated 2002-05-01, with a file datestamp of 2002-05-01.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ik0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ik0A (A:)
mgpvppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsai
ektqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn