PDB entry 1ijx

View 1ijx on RCSB PDB site
Description: crystal structure of the cysteine-rich domain of secreted frizzled-related protein 3 (sfrp-3;fzb)
Class: signaling protein
Keywords: wnt receptor, frizzled protein structure, cysteine-rich, signaling protein
Deposited on 2001-04-30, released 2001-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.22
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: secreted frizzled-related sequence protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: SFRP-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97401 (2-126)
      • engineered (18)
    Domains in SCOPe 2.06: d1ijxa_
  • Chain 'B':
    Compound: secreted frizzled-related sequence protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: SFRP-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97401 (2-End)
      • engineered (18)
    Domains in SCOPe 2.06: d1ijxb_
  • Chain 'C':
    Compound: secreted frizzled-related sequence protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: SFRP-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97401 (2-126)
      • engineered (18)
    Domains in SCOPe 2.06: d1ijxc_
  • Chain 'D':
    Compound: secreted frizzled-related sequence protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: SFRP-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97401
      • engineered (18)
    Domains in SCOPe 2.06: d1ijxd_
  • Chain 'E':
    Compound: secreted frizzled-related sequence protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: SFRP-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97401
      • engineered (18)
    Domains in SCOPe 2.06: d1ijxe_
  • Chain 'F':
    Compound: secreted frizzled-related sequence protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: SFRP-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97401 (2-126)
      • engineered (18)
    Domains in SCOPe 2.06: d1ijxf_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ijxA (A:)
    gsaacepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflca
    myapictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcisp
    eaivtad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ijxA (A:)
    aacepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflcamy
    apictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcispea
    ivtad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ijxB (B:)
    gsaacepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflca
    myapictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcisp
    eaivtad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ijxB (B:)
    aacepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflcamy
    apictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcispea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ijxC (C:)
    gsaacepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflca
    myapictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcisp
    eaivtad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ijxC (C:)
    aacepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflcamy
    apictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcispea
    ivtad
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ijxD (D:)
    gsaacepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflca
    myapictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcisp
    eaivtad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ijxD (D:)
    acepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflcamya
    pictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcispeai
    vt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ijxE (E:)
    gsaacepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflca
    myapictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcisp
    eaivtad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ijxE (E:)
    acepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflcamya
    pictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcispeai
    vta
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ijxF (F:)
    gsaacepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflca
    myapictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcisp
    eaivtad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ijxF (F:)
    aacepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflcamy
    apictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcispea
    ivtad