PDB entry 1iju

View 1iju on RCSB PDB site
Description: human beta-defensin-1
Class: antibiotic
Keywords: defensin, human beta-defensin-1, beta-defensin
Deposited on 2001-04-30, released 2001-10-24
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.175
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-defensin 1
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60022 (0-35)
  Domains in SCOP 1.75: d1ijua_
• Chain 'B':
  Compound: beta-defensin 1
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60022 (0-35)
  Domains in SCOP 1.75: d1ijub_
• Chain 'C':
  Compound: beta-defensin 1
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60022 (0-35)
  Domains in SCOP 1.75: d1ijuc_
• Chain 'D':
  Compound: beta-defensin 1
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60022 (0-35)
  Domains in SCOP 1.75: d1ijud_
• Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ijuA (A:)
  dhyncvssggqclysacpiftkiqgtcyrgkakcck
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ijuB (B:)
  dhyncvssggqclysacpiftkiqgtcyrgkakcck
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ijuC (C:)
  dhyncvssggqclysacpiftkiqgtcyrgkakcck
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ijuD (D:)
  dhyncvssggqclysacpiftkiqgtcyrgkakcck