PDB entry 1ijr

View 1ijr on RCSB PDB site
Description: Crystal structure of LCK SH2 complexed with nonpeptide phosphotyrosine mimetic
Class: transferase/signaling protein
Keywords: Tyrosine-protein kinase, TRANSFERASE/SIGNALING PROTEIN COMPLEX
Deposited on 2001-04-27, released 2002-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.23
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239 (0-103)
      • conflict (0)
      • conflict (41)
    Domains in SCOPe 2.08: d1ijra_
  • Heterogens: CC0

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ijrA (A:)
    apepwffknlsrkdaerqllapgnthgsfliresestagsfclsvrdfdqnqgevvkhyk
    irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt