PDB entry 1ijn

View 1ijn on RCSB PDB site
Description: Crystal structure of the transthyretin mutant TTR C10A/Y114C
Class: transport protein
Keywords: greek key, beta barrel, transport protein
Deposited on 2001-04-27, released 2003-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.207
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (9)
      • engineered (113)
    Domains in SCOPe 2.07: d1ijna_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (9)
      • engineered (113)
    Domains in SCOPe 2.07: d1ijnb_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ijnA (A:)
    gptgtgeskaplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspcsystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ijnA (A:)
    aplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspcsysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ijnB (B:)
    gptgtgeskaplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspcsystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ijnB (B:)
    aplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspcsysttavvtn