PDB entry 1ijl

View 1ijl on RCSB PDB site
Description: Crystal structure of acidic phospholipase A2 from deinagkistrodon acutus
Class: hydrolase
Keywords: three long helix, one two strand beta sheet, calcium binding loop, hydrolase
Deposited on 2001-04-27, released 2001-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.184
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Deinagkistrodon acutus [TaxId:36307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ijla_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Deinagkistrodon acutus [TaxId:36307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ijlb_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ijlA (A:)
sliqfetlimkvvkksgmfwysaygcycgwgghgrpqdatdrccfvhdccygkvtgcdpk
mdsytyseengdivcggddpckreicecdrvaadcfrdnldtynsdtywryprqdceesp
epc

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ijlB (B:)
sliqfetlimkvvkksgmfwysaygcycgwgghgrpqdatdrccfvhdccygkvtgcdpk
mdsytyseengdivcggddpckreicecdrvaadcfrdnldtynsdtywryprqdceesp
epc