PDB entry 1iji

View 1iji on RCSB PDB site
Description: Crystal Structure of L-Histidinol Phosphate Aminotransferase with PLP
Class: transferase
Keywords: Aminotransferase, HisC, Histidine biosynthesis, Pyridoxal Phosphate, TRANSFERASE
Deposited on 2001-04-26, released 2001-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidinol phosphate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ijia_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ijiA (A:)
    mstvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqp
    kavienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaeti
    gvecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkai
    vvadeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkvi
    apyplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyi
    larfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ijiA (A:)
    tvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqpka
    vienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaetigv
    ecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivv
    adeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkviap
    yplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyila
    rfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv