PDB entry 1ijf

View 1ijf on RCSB PDB site
Description: Nucleotide exchange mechanisms in the eEF1A-eEF1Ba complex
Class: translation
Keywords: protein complex, TRANSLATION
Deposited on 2001-04-26, released 2001-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.25
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 1-alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ijfa1, d1ijfa2, d1ijfa3
  • Chain 'B':
    Compound: elongation factor 1-beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TEF5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ijfb_
  • Heterogens: MG, GDP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ijfA (A:)
    mgkekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvl
    dklkaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggv
    gefeagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvg
    ynpktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt
    dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
    vpgdnvgfnvknvsvkeirrgnvcgdakndppkgcasfnatvivlnhpgqisagyspvld
    chtahiacrfdellekndrrsgkkledhpkflksgdaalvkfvpskpmcveafseypplg
    rfavrdmrqtvavgviksvdktekaakvtkaaqkaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ijfA (A:)
    gkekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvld
    klkaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvg
    efeagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgy
    npktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrptd
    kplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqgv
    pgdnvgfnvknvsvkeirrgnvcgdakndppkgcasfnatvivlnhpgqisagyspvldc
    htahiacrfdellekndrrsgkkledhpkflksgdaalvkfvpskpmcveafseypplgr
    favrdmrqtvavgviksvdk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ijfB (B:)
    paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
    dkvslddlqqsieededhvqstdiaamqkl