PDB entry 1ije

View 1ije on RCSB PDB site
Description: Nucleotide Exchange Intermediates in the eEF1A-eEF1Ba Complex
Class: translation
Keywords: protein complex, TRANSLATION
Deposited on 2001-04-26, released 2001-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 1-alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ijea1, d1ijea2, d1ijea3
  • Chain 'B':
    Compound: elongation factor 1-beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TEF5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ijeb_
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ijeA (A:)
    mgkekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvl
    dklkaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggv
    gefeagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvg
    ynpktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt
    dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
    vpgdnvgfnvknvsvkeirrgnvcgdakndppkgcasfnatvivlnhpgqisagyspvld
    chtahiacrfdellekndrrsgkkledhpkflksgdaalvkfvpskpmcveafseypplg
    rfavrdmrqtvavgviksvdktekaakvtkaaqkaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ijeA (A:)
    ekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvldkl
    kaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvgef
    eagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgynp
    ktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrptdkp
    lrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqgvpg
    dnvgfnvknvsvkeirrgnvcgdakndppkgcasfnatvivlnhpgqisagyspvldcht
    ahiacrfdellekndrrsgkkledhpkflksgdaalvkfvpskpmcveafseypplgrfa
    vrdmrqtvavgviksvdk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ijeB (B:)
    paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
    dkvslddlqqsieededhvqstdiaamqkl