PDB entry 1ija

View 1ija on RCSB PDB site
Description: Structure of Sortase
Class: protein binding
Keywords: Eight stranded Beta Barrel, Transpeptidase, PROTEIN BINDING
Deposited on 2001-04-25, released 2001-05-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sortase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9S446 (1-147)
      • initiating methionine (0)
    Domains in SCOPe 2.03: d1ijaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ijaA (A:)
    mqakpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisia
    ghtfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkq
    ltlitcddynektgvwekrkifvatevk