PDB entry 1ij8

View 1ij8 on RCSB PDB site
Description: crystal structure of lite avidin-bni complex
Class: unknown function
Keywords: avidin, streptavidin, pseudo enzymatic activity
Deposited on 2001-04-25, released 2001-09-12
The last revision prior to the SCOP 1.75 freeze date was dated 2002-12-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • see remark 999 (33)
    Domains in SCOP 1.75: d1ij8a_
  • Chain 'B':
    Compound: Avidin
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • see remark 999 (33)
    Domains in SCOP 1.75: d1ij8b_
  • Heterogens: NDG, BNI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ij8A (A:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ij8A (A:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtneikesplhgtentinkrtqptfg
    ftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ij8B (B:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ij8B (B:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtneikesplhgtentinkrtqptf
    gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl