PDB entry 1ij8

View 1ij8 on RCSB PDB site
Description: crystal structure of lite avidin-bni complex
Deposited on 2001-04-25, released 2001-09-12
The last revision prior to the SCOP 1.67 freeze date was dated 2001-09-12, with a file datestamp of 2001-09-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ij8a_
  • Chain 'B':
    Domains in SCOP 1.67: d1ij8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ij8A (A:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ij8A (A:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtneikesplhgtentinkrtqptfg
    ftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ij8B (B:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ij8B (B:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtneikesplhgtentinkrtqptf
    gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl