PDB entry 1ij7

View 1ij7 on RCSB PDB site
Description: crystal structure of earthworm fibrinolytic enzyme component a from eisenia fetida
Class: hydrolase
Keywords: hydrolase, serine protease (elastase-like), fibrinolytic enzyme
Deposited on 2001-04-25, released 2002-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2002-08-14, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Earthworm Fibrinolytic Enzyme
    Species: EISENIA FETIDA
    Gene:
    Domains in SCOPe 2.07: d1ij7a_
  • Chain 'B':
    Compound: Earthworm Fibrinolytic Enzyme
    Species: EISENIA FETIDA
    Gene:
    Domains in SCOPe 2.07: d1ij7b_
  • Chain 'C':
    Compound: Earthworm Fibrinolytic Enzyme
    Species: EISENIA FETIDA
    Gene:
    Domains in SCOPe 2.07: d1ij7c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ij7A (A:)
    viggtnaspgefpwqlsqqrqsgswshscgasllsstsalsashcvdgvlpnnirviagl
    wqqsdtsgtqtanvdsytmhenygagtasysndiailhlatsislggniqaavlpannnn
    dyagttcvisgwgrtdgtnnlpdilqkssipvittaqctaamvgvgganiwdnhicvqdp
    agntgacngdsggplncpdggtrvvgvtswvvssglgaclpdypsvytrvsaylgwigdn
    s
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ij7B (B:)
    viggtnaspgefpwqlsqqrqsgswshscgasllsstsalsashcvdgvlpnnirviagl
    wqqsdtsgtqtanvdsytmhenygagtasysndiailhlatsislggniqaavlpannnn
    dyagttcvisgwgrtdgtnnlpdilqkssipvittaqctaamvgvgganiwdnhicvqdp
    agntgacngdsggplncpdggtrvvgvtswvvssglgaclpdypsvytrvsaylgwigdn
    s
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ij7C (C:)
    viggtnaspgefpwqlsqqrqsgswshscgasllsstsalsashcvdgvlpnnirviagl
    wqqsdtsgtqtanvdsytmhenygagtasysndiailhlatsislggniqaavlpannnn
    dyagttcvisgwgrtdgtnnlpdilqkssipvittaqctaamvgvgganiwdnhicvqdp
    agntgacngdsggplncpdggtrvvgvtswvvssglgaclpdypsvytrvsaylgwigdn
    s