PDB entry 1ij2

View 1ij2 on RCSB PDB site
Description: gcn4-pvtl coiled-coil trimer with threonine at the a(16) position
Deposited on 2001-04-24, released 2001-08-08
The last revision prior to the SCOP 1.61 freeze date was dated 2001-08-08, with a file datestamp of 2001-08-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.243
AEROSPACI score: -1.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1ij2a_
  • Chain 'B':
    Domains in SCOP 1.61: d1ij2b_
  • Chain 'C':
    Domains in SCOP 1.61: d1ij2c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ij2A (A:)
rmkqledkveellsktyhlenevarlkklv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ij2B (B:)
rmkqledkveellsktyhlenevarlkklvge

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ij2C (C:)
rmkqledkveellsktyhlenevarlkklvg