PDB entry 1iit

View 1iit on RCSB PDB site
Description: glur0 ligand binding core complex with l-serine
Class: membrane protein
Keywords: membrane protein, same fold as pbps
Deposited on 2001-04-24, released 2001-09-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Slr1257 protein
    Species: Synechocystis sp. PCC 6803 substr. Kazusa [TaxId:1111708]
    Gene: slr1257, slr1257 GluR0
    Database cross-references and differences (RAF-indexed):
    • Uniprot P73797 (5-101)
      • expression tag (0-4)
      • linker (102)
    • Uniprot P73797 (103-End)
    Domains in SCOPe 2.06: d1iita1, d1iita2
  • Heterogens: SER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iitA (A:)
    gsamalkvgvvgnppfvfygegknaaftgisldvwravaesqkwnseyvrqnsisagita
    vaegeldiligpisvtperaaiegitftqpyfssgigllipgtatplfrsvgdlknkeva
    vvrdttavdwanfyqadvretnnltaaitllqkkqveavmfdrpaliyytrqnpnlnlev
    teirvslepygfvlkensplqktinvemlnllysrviaefterwlgpgieen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iitA (A:)
    gsamalkvgvvgnppfvfygaftgisldvwravaesqkwnseyvrqnsisagitavaege
    ldiligpisvtperaaiegitftqpyfssgigllipgtatplfrsvgdlknkevavvrdt
    tavdwanfyqadvretnnltaaitllqkkqveavmfdrpaliyytrqnpnlnlevteirv
    slepygfvlkensplqktinvemlnllysrviaefterwlg