PDB entry 1iis

View 1iis on RCSB PDB site
Description: Crystal Structure of a Human Fcg Receptor in Complex with an Fc Fragment of IgG1 (orthorhombic)
Class: immune system
Keywords: beta sandwich, immunoglobulin fold
Deposited on 2001-04-24, released 2001-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-07-24, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.23
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (0-223)
      • see remark 999 (48)
      • see remark 999 (88)
      • see remark 999 (91)
      • see remark 999 (132)
      • see remark 999 (134)
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (0-223)
      • see remark 999 (48)
      • see remark 999 (88)
      • see remark 999 (91)
      • see remark 999 (132)
      • see remark 999 (134)
    Domains in SCOPe 2.07: d1iisb3, d1iisb4
  • Chain 'C':
    Compound: low affinity immunoglobulin gamma fc region receptor III-b
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iisB (B:)
    htcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgve
    vhnaktkpreeqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqp
    repqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgs
    fflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iisB (B:)
    pellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvevhnaktkp
    reeqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytl
    ppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysklt
    vdksrwqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'C':
    No sequence available.