PDB entry 1iir

View 1iir on RCSB PDB site
Description: Crystal Structure of UDP-glucosyltransferase GtfB
Deposited on 2001-04-24, released 2001-07-18
The last revision prior to the SCOP 1.71 freeze date was dated 2001-07-18, with a file datestamp of 2001-07-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.211
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1iira_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iirA (A:)
    mrvllatcgsrgdteplvalavrvrdlgadvrmcappdcaerlaevgvphvpvgpsarap
    iqrakpltaedvrrftteaiatqfdeipaaaegcaavvttgllaaaigvrsvaeklgipy
    fyafhcpsyvpspyypppplgepstqdtidipaqwernnqsayqryggllnshrdaiglp
    pvediftfgytdhpwvaadpvlaplqptdldavqtgawilpderplspelaafldagppp
    vylgfgslgapadavrvaidairahgrrvilsrgwadlvlpddgadcfaigevnhqvlfg
    rvaavihhggagtthvaaragapqillpqmadqpyyagrvaelgvgvahdgpiptfdsls
    aalataltpetharatavagtirtdgaavaarllldavsrekptvsalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iirA (A:)
    mrvllatcgsrgdteplvalavrvrdlgadvrmcappdcaerlaevgvphvpvgprakpl
    taedvrrftteaiatqfdeipaaaegcaavvttgllaaaigvrsvaeklgipyfyafhcp
    syvpspyyppppidipaqwernnqsayqryggllnshrdaiglppvediftfgytdhpwv
    aadpvlaplqptdldavqtgawilpderplspelaafldagpppvylgfgapadavrvai
    dairahgrrvilsrgwadlvlpddgadcfaigevnhqvlfgrvaavihhggagtthvaar
    agapqillpqmadqpyyagrvaelgvgvahdgpiptfdslsaalataltpetharatava
    gtirtdgaavaarllldavsre