PDB entry 1iip

View 1iip on RCSB PDB site
Description: Bovine Cyclophilin 40, Tetragonal Form
Deposited on 2001-04-24, released 2001-05-16
The last revision prior to the SCOP 1.63 freeze date was dated 2001-05-16, with a file datestamp of 2001-05-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.236
AEROSPACI score: -1.61 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iipA (A:)
    shpspqakpsnpsnprvffdvdiggervgrivlelfadivpktaenfralctgekgigpt
    tgkplhfkgcpfhriikkfmiqggdfsnqngtggesiygekfedenfhykhdkegllsma
    nagsntngsqffittvptphldgkhvvfgqvikgmgvakilenvevkgekpaklcviaec
    gelkegddwgifpkdgsgdshpdfpedadvdlkdvdkillisedlknigntffksqnwem
    aikkytkvlryvegsraaaedadgaklqpvalscvlnigacklkmsdwqgavdscle