PDB entry 1iio

View 1iio on RCSB PDB site
Description: NMR-Based Structure of the Conserved Protein MTH865 from the Archea Methanobacterium thermoautotrophicum
Class: structural genomics, unknown function
Keywords: 4-helical bundle, monomer, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2001-04-23, released 2001-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein MTH865
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: ORF 865
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04926 (3-83)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d1iioa1, d1iioa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iioA (A:)
    gshmkmgvkedirgqiigalagadfpinspeelmaalpngpdttcksgdvelkasdagqv
    ltaddfpfksaeevadtivnkagl