PDB entry 1iil

View 1iil on RCSB PDB site
Description: crystal structure of pro253arg apert mutant fgf receptor 2 (fgfr2) in complex with fgf2
Class: growth factor/growth factor receptor
Keywords: immunoglobulin like domain, b-trefoil, growth factor/growth factor receptor complex
Deposited on 2001-04-23, released 2001-05-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.237
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038 (Start-154)
      • engineered (77)
      • engineered (95)
    Domains in SCOPe 2.06: d1iila_
  • Chain 'B':
    Compound: heparin-binding growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • engineered (77)
      • engineered (95)
    Domains in SCOPe 2.06: d1iilb_
  • Chain 'C':
    Compound: heparin-binding growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038 (Start-154)
      • engineered (77)
      • engineered (95)
    Domains in SCOPe 2.06: d1iilc_
  • Chain 'D':
    Compound: heparin-binding growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • engineered (77)
      • engineered (95)
    Domains in SCOPe 2.06: d1iild_
  • Chain 'E':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered (106)
    Domains in SCOPe 2.06: d1iile1, d1iile2
  • Chain 'F':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered (106)
    Domains in SCOPe 2.06: d1iilf1, d1iilf2
  • Chain 'G':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered (106)
    Domains in SCOPe 2.06: d1iilg1, d1iilg2
  • Chain 'H':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered (106)
    Domains in SCOPe 2.06: d1iilh1, d1iilh2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iilA (A:)
    maagsittlpalpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphi
    klqlqaeergvvsikgvsanrylamkedgrllasksvtdecffferlesnnyntyrsrky
    tswyvalkrtgqyklgsktgpgqkailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iilA (A:)
    ppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanr
    ylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgp
    gqkailflpmsaks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iilB (B:)
    maagsittlpalpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphi
    klqlqaeergvvsikgvsanrylamkedgrllasksvtdecffferlesnnyntyrsrky
    tswyvalkrtgqyklgsktgpgqkailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iilB (B:)
    ppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanr
    ylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgp
    gqkailflpmsak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1iilC (C:)
    maagsittlpalpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphi
    klqlqaeergvvsikgvsanrylamkedgrllasksvtdecffferlesnnyntyrsrky
    tswyvalkrtgqyklgsktgpgqkailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iilC (C:)
    ghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryl
    amkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgq
    kailflpmsaks
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1iilD (D:)
    maagsittlpalpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphi
    klqlqaeergvvsikgvsanrylamkedgrllasksvtdecffferlesnnyntyrsrky
    tswyvalkrtgqyklgsktgpgqkailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iilD (D:)
    pghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanry
    lamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpg
    qkailflpmsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1iilE (E:)
    nsnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrigg
    ykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversrhrpilqaglpana
    stvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeiev
    lyirnvtfedageytclagnsigisfhsawltvlpapgre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iilE (E:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversrhrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdkeievlyirnvtfedageyt
    clagnsigisfhsawltvlp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1iilF (F:)
    nsnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrigg
    ykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversrhrpilqaglpana
    stvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeiev
    lyirnvtfedageytclagnsigisfhsawltvlpapgre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iilF (F:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversrhrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdkeievlyirnvtfedageyt
    clagnsigisfhsawltvlp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1iilG (G:)
    nsnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrigg
    ykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversrhrpilqaglpana
    stvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeiev
    lyirnvtfedageytclagnsigisfhsawltvlpapgre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iilG (G:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversrhrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievlyi
    rnvtfedageytclagnsigisfhsawltvlpapg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1iilH (H:)
    nsnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrigg
    ykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversrhrpilqaglpana
    stvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeiev
    lyirnvtfedageytclagnsigisfhsawltvlpapgre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iilH (H:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversrhrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievlyi
    rnvtfedageytclagnsigisfhsawltvlpapg