PDB entry 1iik

View 1iik on RCSB PDB site
Description: crystal structure of the transthyretin mutant ttr y114c-data collected at cryo temperature
Class: transport protein
Keywords: greek key, beta barrel, transport protein
Deposited on 2001-04-23, released 2002-11-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (113)
    Domains in SCOPe 2.03: d1iika_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (113)
    Domains in SCOPe 2.03: d1iikb_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iikA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspcsystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iikA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspcsysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iikB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspcsystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iikB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspcsysttavvtn