PDB entry 1ii9

View 1ii9 on RCSB PDB site
Description: crystal structure of the escherichia coli arsenite-translocating ATPase in complex with amp-pnp
Class: hydrolase
Keywords: ArsA ATPase, AMP-PNP, ATP binding site, HYDROLASE
Deposited on 2001-04-21, released 2001-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arsenical pump-driving ATPase
    Species: Escherichia coli [TaxId:562]
    Gene: ARSA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08690
      • see remark 999 (59)
      • expression tag (583-588)
    Domains in SCOPe 2.07: d1ii9a1, d1ii9a2, d1ii9a3
  • Chain 'B':
    Compound: arsenical pump-driving ATPase
    Species: Escherichia coli [TaxId:562]
    Gene: ARSA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08690 (0-582)
      • see remark 999 (59)
      • expression tag (583-588)
    Domains in SCOPe 2.07: d1ii9b1, d1ii9b2, d1ii9b3
  • Heterogens: MG, CD, CL, ADP, ANP, TAS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ii9A (A:)
    mqflqnippylfftgkggvgktsiscatairlaeqgkrvllvstdpasnvgqvfsqtign
    tiqaiasvpglsaleidpqaaaqqyrarivdpikgvlpddvvssineqlsgactteiaaf
    deftglltdaslltrfdhiifdtaptghtirllqlpgawssfidsnpegasclgpmagle
    kqreqyayavealsdpkrtrlvlvarlqkstlqevarthlelaaiglknqylvingvlpk
    teaandtlaaaiwereqealanlpadlaglptdtlflqpvnmvgvsalsrllstqpvasp
    ssdeylqqrpdipslsalvddiarnehglimlmgkggvgkttmaaaiavrladmgfdvhl
    ttsdpaahlsmtlngslnnlqvsridpheeteryrqhvletkgkeldeagkrlleedlrs
    pcteeiavfqafsrvireagkrfvvmdtaptghtlllldatgayhreiakkmgekghftt
    pmmllqdpertkvllvtlpettpvleaanlqadleragihpwgwiinnslsiadtrspll
    rmraqqelpqiesvkrqhasrvalvpvlaseptgidklkqlaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii9A (A:)
    mqflqnippylfftgkggvgktsiscatairlaeqgkrvllvstdpasnvgqvfsqtign
    tiqaiasvpglsaleidpqaaaqqyrarivdpikgvlpddvvssineqlsgactteiaaf
    deftglltdaslltrfdhiifdtaptghtirllqlpgawssfidsclgpmaglekqreqy
    ayavealsdpkrtrlvlvarlqkstlqevarthlelaaiglknqylvingvlpkteaand
    tlaaaiwereqealanlpadlaglptdtlflqpvnmvgvsalsrllstqrpdipslsalv
    ddiarnehglimlmgkggvgkttmaaaiavrladmgfdvhlttsdpaahlnnlqvsridp
    heeteryrqhvletkgkeldeagkrlleedlrspcteeiavfqafsrvireagkrfvvmd
    taptghtlllldattpmmllqdpertkvllvtlpettpvleaanlqadleragihpwgwi
    innslsiadtrspllrmraqqelpqiesvkrqhasrvalvpvlaseptgidklkqlaghh
    hhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ii9B (B:)
    mqflqnippylfftgkggvgktsiscatairlaeqgkrvllvstdpasnvgqvfsqtign
    tiqaiasvpglsaleidpqaaaqqyrarivdpikgvlpddvvssineqlsgactteiaaf
    deftglltdaslltrfdhiifdtaptghtirllqlpgawssfidsnpegasclgpmagle
    kqreqyayavealsdpkrtrlvlvarlqkstlqevarthlelaaiglknqylvingvlpk
    teaandtlaaaiwereqealanlpadlaglptdtlflqpvnmvgvsalsrllstqpvasp
    ssdeylqqrpdipslsalvddiarnehglimlmgkggvgkttmaaaiavrladmgfdvhl
    ttsdpaahlsmtlngslnnlqvsridpheeteryrqhvletkgkeldeagkrlleedlrs
    pcteeiavfqafsrvireagkrfvvmdtaptghtlllldatgayhreiakkmgekghftt
    pmmllqdpertkvllvtlpettpvleaanlqadleragihpwgwiinnslsiadtrspll
    rmraqqelpqiesvkrqhasrvalvpvlaseptgidklkqlaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii9B (B:)
    mqflqnippylfftgkggvgktsiscatairlaeqgkrvllvstdpasnvgqvfsqtign
    tiqaiasvpglsaleidpqaaaqqyrarivdpikgvlpddvvssineqlsgactteiaaf
    deftglltdaslltrfdhiifdtaptghtirllqlpgawssfidsegasclgpmaglekq
    reqyayavealsdpkrtrlvlvarlqkstlqevarthlelaaiglknqylvingvlpkte
    aandtlaaaiwereqealanlpadlaglptdtlflqpvnmvgvsalsrllstqqqrpdip
    slsalvddiarnehglimlmgkggvgkttmaaaiavrladmgfdvhlttsdpaalnnlqv
    sridpheeteryrqhvletkgkeldeagkrlleedlrspcteeiavfqafsrvireagkr
    fvvmdtaptghtlllldatttpmmllqdpertkvllvtlpettpvleaanlqadleragi
    hpwgwiinnslsiadtrspllrmraqqelpqiesvkrqhasrvalvpvlaseptgidklk
    qlaghhhhhh