PDB entry 1ii6

View 1ii6 on RCSB PDB site
Description: Crystal Structure of the Mitotic Kinesin Eg5 in Complex with Mg-ADP.
Class: cell cycle
Keywords: Mg-ADP complex
Deposited on 2001-04-20, released 2001-07-18
The last revision prior to the SCOP 1.75 freeze date was dated 2003-09-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kinesin-related motor protein eg5
    Species: HOMO SAPIENS
    Gene: EG5
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ii6a_
  • Chain 'B':
    Compound: kinesin-related motor protein eg5
    Species: HOMO SAPIENS
    Gene: EG5
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ii6b_
  • Heterogens: NO3, MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ii6A (A:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii6A (A:)
    gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgas
    tkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagi
    iprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvi
    ikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeel
    vkigklnlvdlagserareagninqslltlgrvitalvertphvpyreskltrilqdslg
    grtrtsiiatispaslnleetlstleyahraknilnkpev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ii6B (B:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii6B (B:)
    gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgas
    tkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagi
    iprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvi
    ikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeel
    vkigklnlvdlagsenignqslltlgrvitalvertphvpyreskltrilqdslggrtrt
    siiatispaslnleetlstleyahraknilnkpev