PDB entry 1ii4

View 1ii4 on RCSB PDB site
Description: crystal structure of ser252trp apert mutant fgf receptor 2 (fgfr2) in complex with fgf2
Class: growth factor/growth factor receptor
Keywords: immunoglobulin like domain, b-trefoil, growth factor/growth factor receptor complex
Deposited on 2001-04-20, released 2001-05-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-04-07, with a file datestamp of 2009-04-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.238
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • engineered (77)
      • engineered (95)
    Domains in SCOPe 2.05: d1ii4a_
  • Chain 'B':
    Compound: heparin-binding growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • engineered (77)
      • engineered (95)
    Domains in SCOPe 2.05: d1ii4b_
  • Chain 'C':
    Compound: heparin-binding growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • engineered (77)
      • engineered (95)
    Domains in SCOPe 2.05: d1ii4c_
  • Chain 'D':
    Compound: heparin-binding growth factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • engineered (77)
      • engineered (95)
    Domains in SCOPe 2.05: d1ii4d_
  • Chain 'E':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered (105)
    Domains in SCOPe 2.05: d1ii4e1, d1ii4e2
  • Chain 'F':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered (105)
    Domains in SCOPe 2.05: d1ii4f1, d1ii4f2
  • Chain 'G':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered (105)
    Domains in SCOPe 2.05: d1ii4g1, d1ii4g2
  • Chain 'H':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered (105)
    Domains in SCOPe 2.05: d1ii4h1, d1ii4h2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ii4A (A:)
    maagsittlpalpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphi
    klqlqaeergvvsikgvsanrylamkedgrllasksvtdecffferlesnnyntyrsrky
    tswyvalkrtgqyklgsktgpgqkailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii4A (A:)
    fppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsan
    rylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktg
    pgqkailflpmsak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ii4B (B:)
    maagsittlpalpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphi
    klqlqaeergvvsikgvsanrylamkedgrllasksvtdecffferlesnnyntyrsrky
    tswyvalkrtgqyklgsktgpgqkailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii4B (B:)
    fppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsan
    rylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktg
    pgqkailflpmsak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ii4C (C:)
    maagsittlpalpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphi
    klqlqaeergvvsikgvsanrylamkedgrllasksvtdecffferlesnnyntyrsrky
    tswyvalkrtgqyklgsktgpgqkailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii4C (C:)
    fppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsan
    rylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktg
    pgqkailflpmsak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ii4D (D:)
    maagsittlpalpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphi
    klqlqaeergvvsikgvsanrylamkedgrllasksvtdecffferlesnnyntyrsrky
    tswyvalkrtgqyklgsktgpgqkailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii4D (D:)
    fppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsan
    rylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktg
    pgqkailflpmsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ii4E (E:)
    nsnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrigg
    ykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpana
    stvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeiev
    lyirnvtfedageytclagnsigisfhsawltvlpapgre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii4E (E:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdkeievlyirnvtfedageyt
    clagnsigisfhsawltvlp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ii4F (F:)
    nsnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrigg
    ykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpana
    stvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeiev
    lyirnvtfedageytclagnsigisfhsawltvlpapgre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii4F (F:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdkeievlyirnvtfedageyt
    clagnsigisfhsawltvlp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ii4G (G:)
    nsnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrigg
    ykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpana
    stvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeiev
    lyirnvtfedageytclagnsigisfhsawltvlpapgre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii4G (G:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdkeievlyirnvtfedageyt
    clagnsigisfhsawltvlp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ii4H (H:)
    nsnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrigg
    ykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpana
    stvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeiev
    lyirnvtfedageytclagnsigisfhsawltvlpapgre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii4H (H:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdkeievlyirnvtfedageyt
    clagnsigisfhsawltvlp