PDB entry 1ii3

View 1ii3 on RCSB PDB site
Description: Structure of S. nuclease quintuple mutant V23I/V66L/I72L/I92L/V99L
Class: hydrolase
Keywords: hydrolase
Deposited on 2001-04-20, released 2003-06-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.2
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal nuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (22)
      • engineered (65)
      • engineered (71)
      • engineered (91)
      • engineered (98)
    Domains in SCOPe 2.05: d1ii3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ii3A (A:)
    atstkklhkepatlikaidgdtiklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmlenakklevefdkgqrtdkygrglaylyadgkmlnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii3A (A:)
    klhkepatlikaidgdtiklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
    lenakklevefdkgqrtdkygrglaylyadgkmlnealvrqglakvayvykpnntheqhl
    rkseaqakkeklniws