PDB entry 1ihy

View 1ihy on RCSB PDB site
Description: GAPDH complexed with ADP-ribose
Class: oxidoreductase
Keywords: GAPDH, D-glyceraldehyde-3-phosphate dehydrogenase, ADP-ribose, OXIDOREDUCTASE
Deposited on 2001-04-20, released 2002-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.176
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Palinurus versicolor [TaxId:82835]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56649 (0-332)
      • see remark 999 (17)
      • see remark 999 (57)
      • see remark 999 (259)
    Domains in SCOPe 2.06: d1ihya1, d1ihya2
  • Chain 'B':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Palinurus versicolor [TaxId:82835]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56649 (0-332)
      • see remark 999 (17)
      • see remark 999 (57)
      • see remark 999 (259)
    Domains in SCOPe 2.06: d1ihyb1, d1ihyb2
  • Chain 'C':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Palinurus versicolor [TaxId:82835]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56649 (0-332)
      • see remark 999 (17)
      • see remark 999 (57)
      • see remark 999 (259)
    Domains in SCOPe 2.06: d1ihyc1, d1ihyc2
  • Chain 'D':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Palinurus versicolor [TaxId:82835]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56649 (0-332)
      • see remark 999 (17)
      • see remark 999 (57)
      • see remark 999 (259)
    Domains in SCOPe 2.06: d1ihyd1, d1ihyd2
  • Heterogens: SO4, APR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihyA (A:)
    skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamktasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihyB (B:)
    skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamktasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihyC (C:)
    skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamktasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihyD (D:)
    skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamktasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa