PDB entry 1ihw

View 1ihw on RCSB PDB site
Description: solution structure of the DNA binding domain of hiv-1 integrase, nmr, 40 structures
Class: DNA-binding protein
Keywords: DNA-binding protein, aids, polyprotein
Deposited on 1995-05-12, released 1996-07-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04586 (1-51)
      • conflict (15)
      • conflict (46)
    Domains in SCOPe 2.04: d1ihwa_
  • Chain 'B':
    Compound: hiv-1 integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04586 (1-51)
      • conflict (15)
      • conflict (46)
    Domains in SCOPe 2.04: d1ihwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihwA (A:)
    miqnfrvyyrdsrdpvwkgpakllwkgegavviqdnsdikvvprrkakiird
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihwB (B:)
    miqnfrvyyrdsrdpvwkgpakllwkgegavviqdnsdikvvprrkakiird