PDB entry 1ihw

View 1ihw on RCSB PDB site
Description: solution structure of the dna binding domain of hiv-1 integrase, nmr, 40 structures
Deposited on 1995-05-12, released 1996-07-11
The last revision prior to the SCOP 1.55 freeze date was dated 1996-11-12, with a file datestamp of 1996-11-13.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ihwa_
  • Chain 'B':
    Domains in SCOP 1.55: d1ihwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ihwA (A:)
miqnfrvyyrdsrdpvwkgpakllwkgegavviqdnsdikvvprrkakiird

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ihwB (B:)
miqnfrvyyrdsrdpvwkgpakllwkgegavviqdnsdikvvprrkakiird