PDB entry 1ihu

View 1ihu on RCSB PDB site
Description: crystal structure of the escherichia coli arsenite-translocating ATPase in complex with mg-ADP-alf3
Class: hydrolase
Keywords: Aluminum Fluoride, ADP, ArsA ATPase, ATP binding site, HYDROLASE
Deposited on 2001-04-20, released 2001-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arsenical pump-driving ATPase
    Species: Escherichia coli [TaxId:562]
    Gene: ARSA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08690 (0-582)
      • see remark 999 (59)
      • expression tag (583-585)
    Domains in SCOPe 2.07: d1ihua1, d1ihua2, d1ihua3
  • Heterogens: MG, CD, CL, ADP, AF3, TAS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ihuA (A:)
    mqflqnippylfftgkggvgktsiscatairlaeqgkrvllvstdpasnvgqvfsqtign
    tiqaiasvpglsaleidpqaaaqqyrarivdpikgvlpddvvssineqlsgactteiaaf
    deftglltdaslltrfdhiifdtaptghtirllqlpgawssfidsnpegasclgpmagle
    kqreqyayavealsdpkrtrlvlvarlqkstlqevarthlelaaiglknqylvingvlpk
    teaandtlaaaiwereqealanlpadlaglptdtlflqpvnmvgvsalsrllstqpvasp
    ssdeylqqrpdipslsalvddiarnehglimlmgkggvgkttmaaaiavrladmgfdvhl
    ttsdpaahlsmtlngslnnlqvsridpheeteryrqhvletkgkeldeagkrlleedlrs
    pcteeiavfqafsrvireagkrfvvmdtaptghtlllldatgayhreiakkmgekghftt
    pmmllqdpertkvllvtlpettpvleaanlqadleragihpwgwiinnslsiadtrspll
    rmraqqelpqiesvkrqhasrvalvpvlaseptgidklkqlaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ihuA (A:)
    mqflqnippylfftgkggvgktsiscatairlaeqgkrvllvstdpasnvgqvfsqtign
    tiqaiasvpglsaleidpqaaaqqyrarivdpikgvlpddvvssineqlsgactteiaaf
    deftglltdaslltrfdhiifdtaptghtirllqlpgawssfiasclgpmaglekqreqy
    ayavealsdpkrtrlvlvarlqkstlqevarthlelaaiglknqylvingvlpkteaand
    tlaaaiwereqealanlpadlaglptdtlflqpvnmvgvsalsrllstqpqrpdipslsa
    lvddiarnehglimlmgkggvgkttmaaaiavrladmgfdvhlttsdpannlqvsridph
    eeteryrqhvletkgkeldeagkrlleedlrspcteeiavfqafsrvireagkrfvvmdt
    aptghtlllldattpmmllqdpertkvllvtlpettpvleaanlqadleragihpwgwii
    nnslsiadtrspllrmraqqelpqiesvkrqhasrvalvpvlaseptgidklkqlaghhh