PDB entry 1ihp

View 1ihp on RCSB PDB site
Description: structure of phosphomonoesterase
Class: phosphomonoesterase
Keywords: phosphomonoesterase, hydrolase, glycoprotein
Deposited on 1997-02-04, released 1998-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.155
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phytase
    Species: Aspergillus ficuum [TaxId:5058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ihpa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ihpA (A:)
    scdtvdqgyqcfsetshlwgqyapffslanesvispevpagcrvtfaqvlsrhgaryptd
    skgkkysalieeiqqnattfdgkyaflktynyslgaddltpfgeqelvnsgikfyqryes
    ltrnivpfirssgssrviasgkkfiegfqstklkdpraqpgqsspkidvviseasssnnt
    ldpgtctvfedseladtveanftatfvpsirqrlendlsgvtltdtevtylmdmcsfdti
    ststvdtklspfcdlfthdewinydylqslkkyyghgagnplgptqgvgyaneliarlth
    spvhddtssnhtldsspatfplnstlyadfshdngiisilfalglyngtkplstttveni
    tqtdgfssawtvpfasrlyvemmqcqaeqeplvrvlvndrvvplhgcpvdalgrctrdsf
    vrglsfarsggdwaecfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ihpA (A:)
    scdtvdqgyqcfsetshlwgqyapffslanesvispevpagcrvtfaqvlsrhgaryptd
    skgkkysalieeiqqnattfdgkyaflktynyslgaddltpfgeqelvnsgikfyqryes
    ltrnivpfirssgssrviasgkkfiegfqstklkdpraqpgqsspkidvviseasssnnt
    ldpgtctvfedseladtveanftatfvpsirqrlendlsgvtltdtevtylmdmcsfdti
    sttklspfcdlfthdewinydylqslkkyyghgagnplgptqgvgyaneliarlthspvh
    ddtssnhtldsspatfplnstlyadfshdngiisilfalglyngtkplstttvenitqtd
    gfssawtvpfasrlyvemmqcqaeqeplvrvlvndrvvplhgcpvdalgrctrdsfvrgl
    sfarsggdwaecfa