PDB entry 1ihn

View 1ihn on RCSB PDB site
Description: mt938
Class: STRUCTURAL GENOMICS, unknown function
Keywords: Methanobacterium thermoautotrophicum, Unknown function, Northeast Structural Genomics Consortium, MTH938, MT938, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, NESG
Deposited on 2001-04-19, released 2001-05-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.228
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein MTH938
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O27021 (2-112)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (48)
    Domains in SCOPe 2.06: d1ihna1, d1ihna2
  • Chain 'B':
    Compound: hypothetical protein MTH938
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O27021 (2-112)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (48)
    Domains in SCOPe 2.06: d1ihnb1, d1ihnb2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihnA (A:)
    shmfsdcrfgsvtyrgreyrsdivvhvdgsvtprrkeisrrkygtshvmaeeeleellee
    kpesiiigsgvhgaletgfrsdatvlptceaikryneersagrrvaaiihvtc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihnB (B:)
    shmfsdcrfgsvtyrgreyrsdivvhvdgsvtprrkeisrrkygtshvmaeeeleellee
    kpesiiigsgvhgaletgfrsdatvlptceaikryneersagrrvaaiihvtc