PDB entry 1ihn

View 1ihn on RCSB PDB site
Description: mt938
Class: STRUCTURAL GENOMICS, unknown function
Keywords: Methanobacterium thermoautotrophicum, Unknown function, Northeast Structural Genomics Consortium, MTH938, MT938, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, NESG
Deposited on 2001-04-19, released 2001-05-16
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.228
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein MTH938
  Species: Methanobacterium thermoautotrophicum
  Database cross-references and differences (RAF-indexed):
  • Uniprot O27021 (2-112)
    • cloning artifact (0-1)
    • modified residue (2)
    • modified residue (48)
  Domains in SCOP 1.73: d1ihna_
• Chain 'B':
  Compound: hypothetical protein MTH938
  Species: Methanobacterium thermoautotrophicum
  Database cross-references and differences (RAF-indexed):
  • Uniprot O27021 (2-112)
    • cloning artifact (0-1)
    • modified residue (2)
    • modified residue (48)
  Domains in SCOP 1.73: d1ihnb_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ihnA (A:)
  shmfsdcrfgsvtyrgreyrsdivvhvdgsvtprrkeisrrkygtshvmaeeeleellee
  kpesiiigsgvhgaletgfrsdatvlptceaikryneersagrrvaaiihvtc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ihnB (B:)
  shmfsdcrfgsvtyrgreyrsdivvhvdgsvtprrkeisrrkygtshvmaeeeleellee
  kpesiiigsgvhgaletgfrsdatvlptceaikryneersagrrvaaiihvtc