PDB entry 1ihm

View 1ihm on RCSB PDB site
Description: crystal structure analysis of norwalk virus capsid
Deposited on 2001-04-19, released 2001-05-16
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-16, with a file datestamp of 2001-05-16.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.26
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ihma_
  • Chain 'B':
    Domains in SCOP 1.57: d1ihmb_
  • Chain 'C':
    Domains in SCOP 1.57: d1ihmc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihmA (A:)
    dplamdpvagsstavatagqvnpidpwiinnfvqapqgeftispnntpgdvlfdlslgph
    lnpfllhlsqmyngwvgnmrvrimlagnaftagkiivscippgfgshnltiaqatlfphv
    iadvrtldpievpledvrnvlfhnndrnqqtmrlvcmlytplrtgggtgdsfvvagrvmt
    cpspdfnflflvpptveqktrpftlpnlplsslsnsraplpissmgispdnvqsvqfqng
    rctldgrlvgttpvslshvakirgtsngtvinlteldgtpfhpfegpapigfpdlggcdw
    hinmtqfghssqtqydvdttpdtfvphlgsiqangigsgnyvgvlswisppshpsgsqvd
    lwkipnygssiteathlapsvyppgfgevlvffmskmpgpgaynlpcllpqeyishlase
    qaptvgeaallhyvdpdtgrnlgefkaypdgfltcvpngassgpqqlpingvfvfvswvs
    rfyqlkpvgtas
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihmB (B:)
    ssvdgasgagqlvpevnasdplamdpvagsstavatagqvnpidpwiinnfvqapqgeft
    ispnntpgdvlfdlslgphlnpfllhlsqmyngwvgnmrvrimlagnaftagkiivscip
    pgfgshnltiaqatlfphviadvrtldpievpledvrnvlfhnndrnqqtmrlvcmlytp
    lrtgggtgdsfvvagrvmtcpspdfnflflvpptveqktrpftlpnlplsslsnsraplp
    issmgispdnvqsvqfqngrctldgrlvgttpvslshvakirgtsngtvinlteldgtpf
    hpfegpapigfpdlggcdwhinmtqfghssqtqydvdttpdtfvphlgsiqangigsgny
    vgvlswisppshpsgsqvdlwkipnygssiteathlapsvyppgfgevlvffmskmpgpg
    aynlpcllpqeyishlaseqaptvgeaallhyvdpdtgrnlgefkaypdgfltcvpngas
    sgpqqlpingvfvfvswvsrfyqlkpvgtas
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihmC (C:)
    dplamdpvagsstavatagqvnpidpwiinnfvqapqgeftispnntpgdvlfdlslgph
    lnpfllhlsqmyngwvgnmrvrimlagnaftagkiivscippgfgshnltiaqatlfphv
    iadvrtldpievpledvrnvlfhnndrnqqtmrlvcmlytplrtgggtgdsfvvagrvmt
    cpspdfnflflvpptveqktrpftlpnlplsslsnsraplpissmgispdnvqsvqfqng
    rctldgrlvgttpvslshvakirgtsngtvinlteldgtpfhpfegpapigfpdlggcdw
    hinmtqfghssqtqydvdttpdtfvphlgsiqangigsgnyvgvlswisppshpsgsqvd
    lwkipnygssiteathlapsvyppgfgevlvffmskmpgpgaynlpcllpqeyishlase
    qaptvgeaallhyvdpdtgrnlgefkaypdgfltcvpngassgpqqlpingvfvfvswvs
    rfyqlkpvgtas