PDB entry 1ihm

View 1ihm on RCSB PDB site
Description: crystal structure analysis of norwalk virus capsid
Class: virus
Keywords: Beta-barrel, EF-Tu-LIKE domain caliciviridae, T=3 icosahedral capsid, Icosahedral virus, Virus
Deposited on 2001-04-19, released 2001-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Norwalk virus [TaxId:11983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83884
      • see remark 999 (252)
    Domains in SCOPe 2.08: d1ihma_
  • Chain 'B':
    Compound: capsid protein
    Species: Norwalk virus [TaxId:11983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83884
      • see remark 999 (252)
    Domains in SCOPe 2.08: d1ihmb_
  • Chain 'C':
    Compound: capsid protein
    Species: Norwalk virus [TaxId:11983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83884
      • see remark 999 (252)
    Domains in SCOPe 2.08: d1ihmc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ihmA (A:)
    mmmaskdatssvdgasgagqlvpevnasdplamdpvagsstavatagqvnpidpwiinnf
    vqapqgeftispnntpgdvlfdlslgphlnpfllhlsqmyngwvgnmrvrimlagnafta
    gkiivscippgfgshnltiaqatlfphviadvrtldpievpledvrnvlfhnndrnqqtm
    rlvcmlytplrtgggtgdsfvvagrvmtcpspdfnflflvpptveqktrpftlpnlplss
    lsnsraplpissmgispdnvqsvqfqngrctldgrlvgttpvslshvakirgtsngtvin
    lteldgtpfhpfegpapigfpdlggcdwhinmtqfghssqtqydvdttpdtfvphlgsiq
    angigsgnyvgvlswisppshpsgsqvdlwkipnygssiteathlapsvyppgfgevlvf
    fmskmpgpgaynlpcllpqeyishlaseqaptvgeaallhyvdpdtgrnlgefkaypdgf
    ltcvpngassgpqqlpingvfvfvswvsrfyqlkpvgtassargrlglrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ihmA (A:)
    dplamdpvagsstavatagqvnpidpwiinnfvqapqgeftispnntpgdvlfdlslgph
    lnpfllhlsqmyngwvgnmrvrimlagnaftagkiivscippgfgshnltiaqatlfphv
    iadvrtldpievpledvrnvlfhnndrnqqtmrlvcmlytplrtgggtgdsfvvagrvmt
    cpspdfnflflvpptveqktrpftlpnlplsslsnsraplpissmgispdnvqsvqfqng
    rctldgrlvgttpvslshvakirgtsngtvinlteldgtpfhpfegpapigfpdlggcdw
    hinmtqfghssqtqydvdttpdtfvphlgsiqangigsgnyvgvlswisppshpsgsqvd
    lwkipnygssiteathlapsvyppgfgevlvffmskmpgpgaynlpcllpqeyishlase
    qaptvgeaallhyvdpdtgrnlgefkaypdgfltcvpngassgpqqlpingvfvfvswvs
    rfyqlkpvgtas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ihmB (B:)
    mmmaskdatssvdgasgagqlvpevnasdplamdpvagsstavatagqvnpidpwiinnf
    vqapqgeftispnntpgdvlfdlslgphlnpfllhlsqmyngwvgnmrvrimlagnafta
    gkiivscippgfgshnltiaqatlfphviadvrtldpievpledvrnvlfhnndrnqqtm
    rlvcmlytplrtgggtgdsfvvagrvmtcpspdfnflflvpptveqktrpftlpnlplss
    lsnsraplpissmgispdnvqsvqfqngrctldgrlvgttpvslshvakirgtsngtvin
    lteldgtpfhpfegpapigfpdlggcdwhinmtqfghssqtqydvdttpdtfvphlgsiq
    angigsgnyvgvlswisppshpsgsqvdlwkipnygssiteathlapsvyppgfgevlvf
    fmskmpgpgaynlpcllpqeyishlaseqaptvgeaallhyvdpdtgrnlgefkaypdgf
    ltcvpngassgpqqlpingvfvfvswvsrfyqlkpvgtassargrlglrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ihmB (B:)
    ssvdgasgagqlvpevnasdplamdpvagsstavatagqvnpidpwiinnfvqapqgeft
    ispnntpgdvlfdlslgphlnpfllhlsqmyngwvgnmrvrimlagnaftagkiivscip
    pgfgshnltiaqatlfphviadvrtldpievpledvrnvlfhnndrnqqtmrlvcmlytp
    lrtgggtgdsfvvagrvmtcpspdfnflflvpptveqktrpftlpnlplsslsnsraplp
    issmgispdnvqsvqfqngrctldgrlvgttpvslshvakirgtsngtvinlteldgtpf
    hpfegpapigfpdlggcdwhinmtqfghssqtqydvdttpdtfvphlgsiqangigsgny
    vgvlswisppshpsgsqvdlwkipnygssiteathlapsvyppgfgevlvffmskmpgpg
    aynlpcllpqeyishlaseqaptvgeaallhyvdpdtgrnlgefkaypdgfltcvpngas
    sgpqqlpingvfvfvswvsrfyqlkpvgtas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ihmC (C:)
    mmmaskdatssvdgasgagqlvpevnasdplamdpvagsstavatagqvnpidpwiinnf
    vqapqgeftispnntpgdvlfdlslgphlnpfllhlsqmyngwvgnmrvrimlagnafta
    gkiivscippgfgshnltiaqatlfphviadvrtldpievpledvrnvlfhnndrnqqtm
    rlvcmlytplrtgggtgdsfvvagrvmtcpspdfnflflvpptveqktrpftlpnlplss
    lsnsraplpissmgispdnvqsvqfqngrctldgrlvgttpvslshvakirgtsngtvin
    lteldgtpfhpfegpapigfpdlggcdwhinmtqfghssqtqydvdttpdtfvphlgsiq
    angigsgnyvgvlswisppshpsgsqvdlwkipnygssiteathlapsvyppgfgevlvf
    fmskmpgpgaynlpcllpqeyishlaseqaptvgeaallhyvdpdtgrnlgefkaypdgf
    ltcvpngassgpqqlpingvfvfvswvsrfyqlkpvgtassargrlglrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ihmC (C:)
    dplamdpvagsstavatagqvnpidpwiinnfvqapqgeftispnntpgdvlfdlslgph
    lnpfllhlsqmyngwvgnmrvrimlagnaftagkiivscippgfgshnltiaqatlfphv
    iadvrtldpievpledvrnvlfhnndrnqqtmrlvcmlytplrtgggtgdsfvvagrvmt
    cpspdfnflflvpptveqktrpftlpnlplsslsnsraplpissmgispdnvqsvqfqng
    rctldgrlvgttpvslshvakirgtsngtvinlteldgtpfhpfegpapigfpdlggcdw
    hinmtqfghssqtqydvdttpdtfvphlgsiqangigsgnyvgvlswisppshpsgsqvd
    lwkipnygssiteathlapsvyppgfgevlvffmskmpgpgaynlpcllpqeyishlase
    qaptvgeaallhyvdpdtgrnlgefkaypdgfltcvpngassgpqqlpingvfvfvswvs
    rfyqlkpvgtas