PDB entry 1ihg

View 1ihg on RCSB PDB site
Description: Bovine Cyclophilin 40, monoclinic form
Class: isomerase
Keywords: ppiase immunophilin tetratricopeptide, isomerase
Deposited on 2001-04-19, released 2001-05-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclophilin 40
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ihga1, d1ihga2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ihgA (A:)
    mshpspqakpsnpsnprvffdvdiggervgrivlelfadivpktaenfralctgekgigp
    ttgkplhfkgcpfhriikkfmiqggdfsnqngtggesiygekfedenfhykhdkegllsm
    anagsntngsqffittvptphldgkhvvfgqvikgmgvakilenvevkgekpaklcviae
    cgelkegddwgifpkdgsgdshpdfpedadvdlkdvdkillisedlknigntffksqnwe
    maikkytkvlryvegsraaaedadgaklqpvalscvlnigacklkmsdwqgavdscleal
    eidpsntkalyrraqgwqglkeydqaladlkkaqeiapedkaiqaellkvkqkikaqkdk
    ekaayakmfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ihgA (A:)
    shpspqakpsnpsnprvffdvdiggervgrivlelfadivpktaenfralctgekgigpt
    tgkplhfkgcpfhriikkfmiqggdfsnqngtggesiygekfedenfhykhdkegllsma
    nagsntngsqffittvptphldgkhvvfgqvikgmgvakilenvevkgekpaklcviaec
    gelkegddwgifpkdgsgdshpdfpedadvdlkdvdkillisedlknigntffksqnwem
    aikkytkvlryvegsraaaedadgaklqpvalscvlnigacklkmsdwqgavdscleale
    idpsntkalyrraqgwqglkeydqaladlkkaqeiapedkaiqaellkvkqkikaqkdke
    kaay