PDB entry 1ihc

View 1ihc on RCSB PDB site
Description: X-ray Structure of Gephyrin N-terminal Domain
Class: contractile protein
Keywords: alpha/beta
Deposited on 2001-04-21, released 2001-05-16
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gephyrin
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ihca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ihcA (A:)
    mategmiltnhdhqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivp
    deieeiketlidwcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgsl
    nvtplgmlsrpvcgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevh
    deledlps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ihcA (A:)
    hqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivpdeieeiketlid
    wcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgslnvtplgmlsrpv
    cgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevhd