PDB entry 1ih0

View 1ih0 on RCSB PDB site
Description: Structure of the C-domain of Human Cardiac Troponin C in Complex with Ca2+ Sensitizer EMD 57033
Class: contractile protein
Keywords: Ca2+ binding protein, Ca2+ Sensitizer,, CONTRACTILE PROTEIN
Deposited on 2001-04-18, released 2001-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: cTnC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ih0a_
  • Heterogens: CA, EMD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ih0A (A:)
    gkseeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdgdknndgridy
    deflefmkgve