PDB entry 1igy

View 1igy on RCSB PDB site
Description: structure of immunoglobulin
Class: immunoglobulin
Keywords: intact immunoglobulin, v region, c region, hinge region, immunoglobulin
Deposited on 1997-10-09, released 1998-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.211
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg1 intact antibody mab61.1.3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA38773 (4-212)
      • conflict (5)
    Domains in SCOPe 2.06: d1igya1, d1igya2
  • Chain 'B':
    Compound: igg1 intact antibody mab61.1.3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA51043 (0-433)
      • conflict (1)
      • conflict (4)
      • conflict (7)
      • conflict (10-11)
      • conflict (18)
      • conflict (25-31)
      • conflict (33)
      • conflict (36)
      • conflict (39)
      • conflict (41-42)
      • conflict (48)
      • conflict (50)
      • conflict (52-55)
      • conflict (58)
      • conflict (60-61)
      • conflict (64)
      • conflict (70)
      • conflict (72)
      • conflict (75)
      • conflict (77-79)
      • conflict (81)
      • conflict (85)
      • conflict (87)
      • conflict (95)
      • conflict (97)
      • conflict (99-101)
      • conflict (108)
      • conflict (113)
      • conflict (187-188)
      • conflict (240)
      • conflict (242)
      • conflict (245)
      • conflict (271)
      • conflict (292)
      • conflict (295)
      • conflict (332)
      • conflict (334)
      • conflict (373-374)
      • conflict (377-378)
      • conflict (389)
      • conflict (391)
    Domains in SCOPe 2.06: d1igyb1, d1igyb2, d1igyb3, d1igyb4
  • Chain 'C':
    Compound: igg1 intact antibody mab61.1.3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA38773 (4-212)
      • conflict (5)
    Domains in SCOPe 2.06: d1igyc1, d1igyc2
  • Chain 'D':
    Compound: igg1 intact antibody mab61.1.3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA51043 (0-433)
      • conflict (1)
      • conflict (4)
      • conflict (7)
      • conflict (10-11)
      • conflict (18)
      • conflict (25-31)
      • conflict (33)
      • conflict (36)
      • conflict (39)
      • conflict (41-42)
      • conflict (48)
      • conflict (50)
      • conflict (52-55)
      • conflict (58)
      • conflict (60-61)
      • conflict (64)
      • conflict (70)
      • conflict (72)
      • conflict (75)
      • conflict (77-79)
      • conflict (81)
      • conflict (85)
      • conflict (87)
      • conflict (95)
      • conflict (97)
      • conflict (99-101)
      • conflict (108)
      • conflict (113)
      • conflict (187-188)
      • conflict (240)
      • conflict (242)
      • conflict (245)
      • conflict (271)
      • conflict (292)
      • conflict (295)
      • conflict (332)
      • conflict (334)
      • conflict (373-374)
      • conflict (377-378)
      • conflict (389)
      • conflict (391)
    Domains in SCOPe 2.06: d1igyd1, d1igyd2, d1igyd3, d1igyd4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igyA (A:)
    kcahtvsksmsmsvgervtltckasenvvtyvswyqqkpeqspklliygasnrytgvpdr
    ftgsgsatdftltissvqaedladyhcgqgysypytfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igyB (B:)
    vklqesgaelarpgasvkmsckasgytfttytihwikqrpgqglewigyinpssvytnyn
    qrfkdkatltrdrssntanihlssltsddsavyycvregevpywgqgttvtvssakttpp
    svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpssprpsetvtcnvahpasstkvdkkivprdcgckpcictvpevssvfifppkpkd
    tllitvtpkvtcvvvdiskddpevqfswfvdnvevhtaqtqpreeqfnstfrvvsalpim
    hqdwlngkefkcrvnsaafpapiektisktkgkprapqvytipppkeqmakdkvsltcmi
    tdffpeditvewqsdgqapenykntqpimdtdgsyfvysklnvqksnweagntftcsvlh
    eglhnhhtekslsh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igyC (C:)
    kcahtvsksmsmsvgervtltckasenvvtyvswyqqkpeqspklliygasnrytgvpdr
    ftgsgsatdftltissvqaedladyhcgqgysypytfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igyD (D:)
    vklqesgaelarpgasvkmsckasgytfttytihwikqrpgqglewigyinpssvytnyn
    qrfkdkatltrdrssntanihlssltsddsavyycvregevpywgqgttvtvssakttpp
    svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpssprpsetvtcnvahpasstkvdkkivprdcgckpcictvpevssvfifppkpkd
    tllitvtpkvtcvvvdiskddpevqfswfvdnvevhtaqtqpreeqfnstfrvvsalpim
    hqdwlngkefkcrvnsaafpapiektisktkgkprapqvytipppkeqmakdkvsltcmi
    tdffpeditvewqsdgqapenykntqpimdtdgsyfvysklnvqksnweagntftcsvlh
    eglhnhhtekslsh