PDB entry 1igt

View 1igt on RCSB PDB site
Description: structure of immunoglobulin
Class: immunoglobulin
Keywords: intact immunoglobulin v region c region, immunoglobulin
Deposited on 1996-10-25, released 1997-07-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.209
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg2a intact antibody - mab231
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1IGT (0-213)
    Domains in SCOPe 2.06: d1igta1, d1igta2
  • Chain 'B':
    Compound: igg2a intact antibody - mab231
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1igtb1, d1igtb2, d1igtb3, d1igtb4
  • Chain 'C':
    Compound: igg2a intact antibody - mab231
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1IGT (0-213)
    Domains in SCOPe 2.06: d1igtc1, d1igtc2
  • Chain 'D':
    Compound: igg2a intact antibody - mab231
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1igtd1, d1igtd2, d1igtd3, d1igtd4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igtA (A:)
    divltqspsslsaslgdtititchasqninvwlswyqqkpgnipklliykasnlhtgvps
    rfsgsgsgtgftltisslqpediatyycqqgqsypltfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igtB (B:)
    evklqesggglvqpggslklscatsgftfsdyymywvrqtpekrlewvayisngggstyy
    pdtvkgrftisrdnakntlylqmsrlksedtamyycarhggyyamdywgqgttvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgptikpcppckcpapnllggps
    vfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynst
    lrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemt
    kkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwve
    rnsyscsvvheglhnhhttksfsr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igtC (C:)
    divltqspsslsaslgdtititchasqninvwlswyqqkpgnipklliykasnlhtgvps
    rfsgsgsgtgftltisslqpediatyycqqgqsypltfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igtD (D:)
    evklqesggglvqpggslklscatsgftfsdyymywvrqtpekrlewvayisngggstyy
    pdtvkgrftisrdnakntlylqmsrlksedtamyycarhggyyamdywgqgttvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgptikpcppckcpapnllggps
    vfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynst
    lrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemt
    kkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwve
    rnsyscsvvheglhnhhttksfsr