PDB entry 1igt

View 1igt on RCSB PDB site
Description: structure of immunoglobulin
Deposited on 1996-10-25, released 1997-07-07
The last revision prior to the SCOP 1.69 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.209
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igtA (A:)
    divltqspsslsaslgdtititchasqninvwlswyqqkpgnipklliykasnlhtgvps
    rfsgsgsgtgftltisslqpediatyycqqgqsypltfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igtB (B:)
    evklqesggglvqpggslklscatsgftfsdyymywvrqtpekrlewvayisngggstyy
    pdtvkgrftisrdnakntlylqmsrlksedtamyycarhggyyamdywgqgttvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgptikpcppckcpapnllggps
    vfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynst
    lrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemt
    kkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwve
    rnsyscsvvheglhnhhttksfsr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igtC (C:)
    divltqspsslsaslgdtititchasqninvwlswyqqkpgnipklliykasnlhtgvps
    rfsgsgsgtgftltisslqpediatyycqqgqsypltfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igtD (D:)
    evklqesggglvqpggslklscatsgftfsdyymywvrqtpekrlewvayisngggstyy
    pdtvkgrftisrdnakntlylqmsrlksedtamyycarhggyyamdywgqgttvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgptikpcppckcpapnllggps
    vfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynst
    lrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemt
    kkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwve
    rnsyscsvvheglhnhhttksfsr