PDB entry 1igs

View 1igs on RCSB PDB site
Description: indole-3-glycerolphosphate synthase from sulfolobus solfataricus at 2.0 a resolution
Class: synthase
Keywords: thermostable, tim-barrel, synthase
Deposited on 1995-08-11, released 1996-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: indole-3-glycerolphosphate synthase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: TRPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1igsa_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1igsA (A:)
    mprylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgl
    dverdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqid
    daynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigin
    srdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnp
    ekikefil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igsA (A:)
    prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
    verdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqidd
    aynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigins
    rdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnpe
    kikefil