SCOP 1.73: Structural Classification of Proteins

PDB entry 1igl

View 1igl on RCSB PDB site
Description: solution structure of human insulin-like growth factor II relationship to receptor and binding protein interactions
Class: growth factor
Keywords: growth factor
Deposited on 1994-12-29, released 1995-02-14
The last revision prior to the SCOP 1.73 freeze date was dated 1995-02-14, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: insulin-like growth factor II
Species: HOMO SAPIENS
Database cross-references and differences (RAF-indexed):
- Uniprot P01344 (0-66)
Domains in SCOP 1.73: d1igla_

PDB Chain Sequences:

Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)

>1iglA (A:)
ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
atpakse