PDB entry 1igl

View 1igl on RCSB PDB site
Description: solution structure of human insulin-like growth factor ii relationship to receptor and binding protein interactions
Deposited on 1994-12-29, released 1995-02-14
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-14, with a file datestamp of 1995-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1igl__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1igl_ (-)
  ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
  atpakse