PDB entry 1igj

View 1igj on RCSB PDB site
Description: 26-10 fab:digoxin complex-affinity and specificity due to surface complementarity
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-02-19, released 1993-04-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.176
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg2a-kappa 26-10 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S52028 (0-End)
      • conflict (6)
      • conflict (26)
      • conflict (38)
      • conflict (44)
      • conflict (89)
      • conflict (91)
      • conflict (93)
      • conflict (95-96)
      • conflict (107)
    Domains in SCOPe 2.05: d1igja1, d1igja2
  • Chain 'B':
    Compound: igg2a-kappa 26-10 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S38950 (2-217)
      • conflict (12)
      • conflict (18-19)
      • conflict (23)
      • conflict (27)
      • conflict (31)
      • conflict (33-34)
      • conflict (37)
      • conflict (39-40)
      • conflict (42-43)
      • conflict (45-46)
      • conflict (49)
      • conflict (51)
      • conflict (53)
      • conflict (56)
      • conflict (58)
      • conflict (61)
      • conflict (73)
      • conflict (81-82)
      • conflict (94)
      • insertion (97-98)
      • conflict (99)
      • conflict (101)
      • conflict (103)
      • conflict (110)
      • conflict (112)
    Domains in SCOPe 2.05: d1igjb1, d1igjb2
  • Chain 'C':
    Compound: igg2a-kappa 26-10 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S52028 (0-End)
      • conflict (6)
      • conflict (26)
      • conflict (38)
      • conflict (44)
      • conflict (89)
      • conflict (91)
      • conflict (93)
      • conflict (95-96)
      • conflict (107)
    Domains in SCOPe 2.05: d1igjc1, d1igjc2
  • Chain 'D':
    Compound: igg2a-kappa 26-10 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S38950 (2-217)
      • conflict (12)
      • conflict (18-19)
      • conflict (23)
      • conflict (27)
      • conflict (31)
      • conflict (33-34)
      • conflict (37)
      • conflict (39-40)
      • conflict (42-43)
      • conflict (45-46)
      • conflict (49)
      • conflict (51)
      • conflict (53)
      • conflict (56)
      • conflict (58)
      • conflict (61)
      • conflict (73)
      • conflict (81-82)
      • conflict (94)
      • insertion (97-98)
      • conflict (99)
      • conflict (101)
      • conflict (103)
      • conflict (110)
      • conflict (112)
    Domains in SCOPe 2.05: d1igjd1, d1igjd2
  • Heterogens: DGX

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1igjA (A:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igjA (A:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1igjB (B:)
    evqlqqsgpelvkpgasvrmsckssgyiftdfymnwvrqshgksldyigyispysgvtgy
    nqkfkgkatltvdkssstaymelrsltsedsavyycagssgnkwamdywghgasvtvssa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igjB (B:)
    vqlqqsgpelvkpgasvrmsckssgyiftdfymnwvrqshgksldyigyispysgvtgyn
    qkfkgkatltvdkssstaymelrsltsedsavyycagssgnkwamdywghgasvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1igjC (C:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igjC (C:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1igjD (D:)
    evqlqqsgpelvkpgasvrmsckssgyiftdfymnwvrqshgksldyigyispysgvtgy
    nqkfkgkatltvdkssstaymelrsltsedsavyycagssgnkwamdywghgasvtvssa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igjD (D:)
    vqlqqsgpelvkpgasvrmsckssgyiftdfymnwvrqshgksldyigyispysgvtgyn
    qkfkgkatltvdkssstaymelrsltsedsavyycagssgnkwamdywghgasvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiep