PDB entry 1igj

View 1igj on RCSB PDB site
Description: 26-10 fab:digoxin complex-affinity and specificity due to surface complementarity
Deposited on 1993-02-19, released 1993-04-15
The last revision prior to the SCOP 1.69 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-26.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.176
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1igjA (A:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igjA (A:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1igjB (B:)
    evqlqqsgpelvkpgasvrmsckssgyiftdfymnwvrqshgksldyigyispysgvtgy
    nqkfkgkatltvdkssstaymelrsltsedsavyycagssgnkwamdywghgasvtvssa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igjB (B:)
    vqlqqsgpelvkpgasvrmsckssgyiftdfymnwvrqshgksldyigyispysgvtgyn
    qkfkgkatltvdkssstaymelrsltsedsavyycagssgnkwamdywghgasvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1igjC (C:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igjC (C:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1igjD (D:)
    evqlqqsgpelvkpgasvrmsckssgyiftdfymnwvrqshgksldyigyispysgvtgy
    nqkfkgkatltvdkssstaymelrsltsedsavyycagssgnkwamdywghgasvtvssa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igjD (D:)
    vqlqqsgpelvkpgasvrmsckssgyiftdfymnwvrqshgksldyigyispysgvtgyn
    qkfkgkatltvdkssstaymelrsltsedsavyycagssgnkwamdywghgasvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiep