PDB entry 1igf

View 1igf on RCSB PDB site
Description: crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1991-03-21, released 1992-04-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.18
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-kappa b13i2 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S38864 (1-End)
      • conflict (2)
      • conflict (4)
      • conflict (26)
      • conflict (30-32)
      • conflict (39)
      • conflict (41)
      • conflict (49)
      • conflict (55)
      • conflict (58)
      • conflict (62)
      • conflict (68)
      • conflict (72)
      • conflict (75)
      • conflict (79)
      • conflict (86)
      • conflict (92)
      • conflict (96)
      • conflict (98-99)
      • conflict (101-103)
      • conflict (103)
      • conflict (106)
      • conflict (113-114)
      • conflict (118-119)
      • conflict (192-193)
    Domains in SCOPe 2.05: d1igfh1, d1igfh2
  • Chain 'J':
    Compound: igg1-kappa b13i2 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S38864 (1-End)
      • conflict (2)
      • conflict (4)
      • conflict (26)
      • conflict (30-32)
      • conflict (39)
      • conflict (41)
      • conflict (49)
      • conflict (55)
      • conflict (58)
      • conflict (62)
      • conflict (68)
      • conflict (72)
      • conflict (75)
      • conflict (79)
      • conflict (86)
      • conflict (92)
      • conflict (96)
      • conflict (98-99)
      • conflict (101-103)
      • conflict (103)
      • conflict (106)
      • conflict (113-114)
      • conflict (118-119)
      • conflict (192-193)
    Domains in SCOPe 2.05: d1igfj1, d1igfj2
  • Chain 'L':
    Compound: igg1-kappa b13i2 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR PC4203 (0-218)
      • conflict (25-26)
      • conflict (26)
      • conflict (26)
      • conflict (32)
      • conflict (34)
      • conflict (100)
    Domains in SCOPe 2.05: d1igfl1, d1igfl2
  • Chain 'M':
    Compound: igg1-kappa b13i2 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR PC4203 (0-218)
      • conflict (25-26)
      • conflict (26)
      • conflict (26)
      • conflict (32)
      • conflict (34)
      • conflict (100)
    Domains in SCOPe 2.05: d1igfm1, d1igfm2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1igfH (H:)
    evqlvesggdlvkpggslklscaasgftfsrcamswvrqtpekrlewvagissggsytfy
    pdtvkgrfiisrnnarntlslqmsslrsedtaiyyctryssdpfyfdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igfH (H:)
    evqlvesggdlvkpggslklscaasgftfsrcamswvrqtpekrlewvagissggsytfy
    pdtvkgrfiisrnnarntlslqmsslrsedtaiyyctryssdpfyfdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1igfJ (J:)
    evqlvesggdlvkpggslklscaasgftfsrcamswvrqtpekrlewvagissggsytfy
    pdtvkgrfiisrnnarntlslqmsslrsedtaiyyctryssdpfyfdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igfJ (J:)
    evqlvesggdlvkpggslklscaasgftfsrcamswvrqtpekrlewvagissggsytfy
    pdtvkgrfiisrnnarntlslqmsslrsedtaiyyctryssdpfyfdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igfL (L:)
    dvlmtqtplslpvslgdqasiscrsnqtillsdgdtylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igfM (M:)
    dvlmtqtplslpvslgdqasiscrsnqtillsdgdtylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec