PDB entry 1igf

View 1igf on RCSB PDB site
Description:
Deposited on 1991-03-21, released 1992-04-15
The last revision prior to the SCOP 1.65 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.18
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1igfh1, d1igfh2
  • Chain 'J':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1igfj1, d1igfj2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1igfl1, d1igfl2
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1igfm1, d1igfm2

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1igfH (H:)
    evqlvesggdlvkpggslklscaasgftfsrcamswvrqtpekrlewvagissggsytfy
    pdtvkgrfiisrnnarntlslqmsslrsedtaiyyctryssdpfyfdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igfH (H:)
    evqlvesggdlvkpggslklscaasgftfsrcamswvrqtpekrlewvagissggsytfy
    pdtvkgrfiisrnnarntlslqmsslrsedtaiyyctryssdpfyfdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1igfJ (J:)
    evqlvesggdlvkpggslklscaasgftfsrcamswvrqtpekrlewvagissggsytfy
    pdtvkgrfiisrnnarntlslqmsslrsedtaiyyctryssdpfyfdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igfJ (J:)
    evqlvesggdlvkpggslklscaasgftfsrcamswvrqtpekrlewvagissggsytfy
    pdtvkgrfiisrnnarntlslqmsslrsedtaiyyctryssdpfyfdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igfL (L:)
    dvlmtqtplslpvslgdqasiscrsnqtillsdgdtylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igfM (M:)
    dvlmtqtplslpvslgdqasiscrsnqtillsdgdtylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec